Immunoglubulin-degrading Enzyme, Recombinant, Streptococcus Pyogenes, aa30-341, His-Tag

Artikelnummer: USB-584940
Artikelname: Immunoglubulin-degrading Enzyme, Recombinant, Streptococcus Pyogenes, aa30-341, His-Tag
Artikelnummer: USB-584940
Hersteller Artikelnummer: 584940
Alternativnummer: USB-584940-20,USB-584940-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa30-341 from Streptococcus pyogenes Immunoglubulin-degrading enzyme, fused to 11X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~36.9kD Amino Acid Sequence: DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.9
UniProt: F8V4V0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.