Initiator Protein NS1, Recombinant, Porcine parvovirus, aa277-545, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Initiator Protein NS1, Recombinant, Porcine parvovirus, aa277-545, His-Tag, Myc-Tag
• Artikelnummer: USB-584958
• Hersteller Artikelnummer: 584958
• Alternativnummer: USB-584958-20,USB-584958-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Multifunctional protein which displays endonuclease and helicase activities required for initiating and directing viral DNA replication. Also plays a role in viral packaging and transactivation of several promoters. Binds site-specifically to 2-3 approximate tandem copies within the origins of replication (Ori), unwinds this hairpin region and nicks one DNA strand thereby initiating the rolling circle replication (RCR). Cooperatively binds Ori with host PIF and probably other host factors, which activate the nickase function of NS1. Becomes covalently attached to the 5 end of the nick and provides a 3OH for priming DNA synthesis. The helicase activity unwinds DNA in a 3-5 direction on the longer strand. Inhibits the host cell cycle during the G1/S transition, the S-phase, and the G2/M transition. These arrests may provide essential cellular factors for viral DNA replication. Promotes apoptosis in host cell. Source: Recombinant protein corresponding to aa277-545 from Porcine parvovirus Initiator protein NS1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~35.4kD Amino Acid Sequence: TKKEVSIKCTIRDLVNKRCTSIEDWMMTDPDSYIEMMAQTGGENLIKNTLEITTLTLARTKTAYDLILEKAKPSMLPTFNISNTRTCKIFSMHNWNYIKCCHAITCVLNRQGGKRNTILFHGPASTGKSIIAQHIANLVGNVGCYNAANVNFPFNDCTNKNLIWIEEAGNFSNQVNQFKAICSGQTIRIDQKGKGSKQIEPTPVIMTTNEDITKVRIGCEERPEHTQPIRDRMLNINLTRKLPGDFGLLEETEWPLICAWLVKKGYQAT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 35.4
• UniProt: P18547
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.