Insulin Growth Factor-like Family Member 1, Recombinant, Human, aa25-110, His-Tag, Myc-Tag

Artikelnummer: USB-584962
Artikelname: Insulin Growth Factor-like Family Member 1, Recombinant, Human, aa25-110, His-Tag, Myc-Tag
Artikelnummer: USB-584962
Hersteller Artikelnummer: 584962
Alternativnummer: USB-584962-20,USB-584962-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Probable ligand of the IGFLR1 cell membrane receptor. Source: Recombinant protein corresponding to aa25-110 from human Insulin growth factor-like family member 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~16.8kD Amino Acid Sequence: APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.8
UniProt: Q6UW32
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.