Insulin-like Growth Factor II, Recombinant, Mouse, aa25-91, His-Tag

Produktübersicht

• Artikelname: Insulin-like Growth Factor II, Recombinant, Mouse, aa25-91, His-Tag
• Artikelnummer: USB-584969
• Hersteller Artikelnummer: 584969
• Alternativnummer: USB-584969-20,USB-584969-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

The insulin-like growth factors possess growth-promoting activity (Probable). Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development (Probable). Source: Recombinant protein corresponding to aa25-91 from mouse Insulin-like growth factor II, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~13.4kD Amino Acid Sequence: AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 13.4
• UniProt: P09535
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.