Insulin, Recombinant, Equine, aa1-30, GST-Tag

Artikelnummer: USB-584973
Artikelname: Insulin, Recombinant, Equine, aa1-30, GST-Tag
Artikelnummer: USB-584973
Hersteller Artikelnummer: 584973
Alternativnummer: USB-584973-20,USB-584973-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Source: Recombinant protein corresponding to aa1-30 from equine Insulin, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.1kD Amino Acid Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.1
UniProt: P01310
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.