Interferon alpha-7, Recombinant, Mouse, aa24-190

Artikelnummer: USB-584992
Artikelname: Interferon alpha-7, Recombinant, Mouse, aa24-190
Artikelnummer: USB-584992
Hersteller Artikelnummer: 584992
Alternativnummer: USB-584992-20,USB-584992-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes. Source: Recombinant protein corresponding to aa24-189 from mouse Interferon alpha-7, expressed in E.coli. Molecular Weight: ~19.0kD Amino Acid Sequence: CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19
UniProt: P06799
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.