Interleukin-10, Recombinant, Macaca mulatta, aa19-178, His-Tag

Artikelnummer: USB-585018
Artikelname: Interleukin-10, Recombinant, Macaca mulatta, aa19-178, His-Tag
Artikelnummer: USB-585018
Hersteller Artikelnummer: 585018
Alternativnummer: USB-585018-20,USB-585018-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Source: Recombinant protein corresponding to aa19-178 from Macaca mulatta Interleukin-10, fused to 10X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~21.2kD Amino Acid Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.2
UniProt: P51496
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.