Interleukin-13, Recombinant, Human, aa25-146, hFc-Tag

Artikelnummer: USB-585027
Artikelname: Interleukin-13, Recombinant, Human, aa25-146, hFc-Tag
Artikelnummer: USB-585027
Hersteller Artikelnummer: 585027
Alternativnummer: USB-585027-20,USB-585027-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages. Source: Recombinant protein corresponding to aa25-146 from human Interleukin-13, fused to hFc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~42.2kD Amino Acid Sequence: LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.2
UniProt: P35225
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.