Interleukin-4 Receptor Subunit Alpha, Recombinant, Porcine, aa33-240, His-Tag

Artikelnummer: USB-585059
Artikelname: Interleukin-4 Receptor Subunit Alpha, Recombinant, Porcine, aa33-240, His-Tag
Artikelnummer: USB-585059
Hersteller Artikelnummer: 585059
Alternativnummer: USB-585059-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. Source: Recombinant protein corresponding to aa33-240 from porcine Interleukin-4 receptor subunit alpha, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.2kD Amino Acid Sequence: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.2
UniProt: Q863Z5
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.