Interleukin-7, Recombinant, Human, aa26-177, His-SUMO-Tag

Artikelnummer: USB-585067
Artikelname: Interleukin-7, Recombinant, Human, aa26-177, His-SUMO-Tag
Artikelnummer: USB-585067
Hersteller Artikelnummer: 585067
Alternativnummer: USB-585067-20,USB-585067-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Source: Recombinant protein corresponding to aa26-177 from human Interleukin-7, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~33.4kD Amino Acid Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.4
UniProt: P13232
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.