Interleukin-8, Recombinant, Canine, aa23-101, His-Tag

Artikelnummer: USB-585068
Artikelname: Interleukin-8, Recombinant, Canine, aa23-101, His-Tag
Artikelnummer: USB-585068
Hersteller Artikelnummer: 585068
Alternativnummer: USB-585068-20,USB-585068-100
Hersteller: US Biological
Kategorie: Molekularbiologie
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. Source: Recombinant protein corresponding to aa23-101 from canine Interleukin-8, fused to 10X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~13.1kD Amino Acid Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 13.1
UniProt: P41324
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.