Internalin-A, Recombinant, Listeria Monocytogenes Serotype 4b, aa562-770, His-Tag

Artikelnummer: USB-585073
Artikelname: Internalin-A, Recombinant, Listeria Monocytogenes Serotype 4b, aa562-770, His-Tag
Artikelnummer: USB-585073
Hersteller Artikelnummer: 585073
Alternativnummer: USB-585073-20,USB-585073-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Mediates the entry of Listeria monocytogenes into cells. Binds to host receptor cadherin-1 (E-cadherin, CDH1). Source: Recombinant protein corresponding to aa562-770 from Listeria monocytogenes serotype 4b Internalin-A, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.5kD Amino Acid Sequence: QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24.5
UniProt: Q723K6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.