Intestinal-type Alkaline Phosphatase 1, Recombinant, Rat, aa21-511, His-Tag

Produktübersicht

• Artikelname: Intestinal-type Alkaline Phosphatase 1, Recombinant, Rat, aa21-511, His-Tag
• Artikelnummer: USB-585077
• Hersteller Artikelnummer: 585077
• Alternativnummer: USB-585077-20,USB-585077-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Alkaline phosphatase that can hydrolyze various phosphate compounds. Source: Recombinant protein corresponding to aa21-511 from rat Intestinal-type alkaline phosphatase 1, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~55.2kD Amino Acid Sequence: VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 55.2
• UniProt: P15693
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.