Kallikrein-10, Recombinant, Human, aa31-274, His-Tag

Artikelnummer: USB-585095
Artikelname: Kallikrein-10, Recombinant, Human, aa31-274, His-Tag
Artikelnummer: USB-585095
Hersteller Artikelnummer: 585095
Alternativnummer: USB-585095-20,USB-585095-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Has a tumor-suppressor role for NES1 in breast and prostate cancer. Source: Recombinant protein corresponding to aa31-274 from human Kallikrein-10, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.8kD Amino Acid Sequence: AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.8
UniProt: O43240
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.