Killer Cell Immunoglobulin-like Receptor 2DS3, Recombinant, Human, aa22-245, MBP-Tag, His-Tag

Artikelnummer: USB-585119
Artikelname: Killer Cell Immunoglobulin-like Receptor 2DS3, Recombinant, Human, aa22-245, MBP-Tag, His-Tag
Artikelnummer: USB-585119
Hersteller Artikelnummer: 585119
Alternativnummer: USB-585119-20,USB-585119-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Source: Recombinant protein corresponding to human Killer cell immunoglobulin-like receptor 2DS3, fused to MBP-Tag at N-terminal and 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~68.7kD Amino Acid Sequence: HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 68.7
UniProt: Q14952
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.