L-ascorbate Peroxidase 2, Cytosolic, Recombinant, Arabidopsis thaliana, aa4-250, His-Tag

Artikelnummer: USB-585132
Artikelname: L-ascorbate Peroxidase 2, Cytosolic, Recombinant, Arabidopsis thaliana, aa4-250, His-Tag
Artikelnummer: USB-585132
Hersteller Artikelnummer: 585132
Alternativnummer: USB-585132-20,USB-585132-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a key role in hydrogen peroxide removal. Partial recombinant protein corresponding to aa4-250 from Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.5kD Amino Acid Sequence: KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.5
UniProt: Q1PER6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.