L-rhamnose-binding Lectin CSL3, Recombinant, Oncorhynchus keta, aa1-195, His-Tag

Artikelnummer: USB-585141
Artikelname: L-rhamnose-binding Lectin CSL3, Recombinant, Oncorhynchus keta, aa1-195, His-Tag
Artikelnummer: USB-585141
Hersteller Artikelnummer: 585141
Alternativnummer: USB-585141-20
Hersteller: US Biological
Kategorie: Molekularbiologie
L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis. Source: Recombinant protein corresponding to aa1-195 from Oncorhynchus keta L-rhamnose-binding lectin CSL3, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.0kD Amino Acid Sequence: AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24
UniProt: P86179
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.