Laminin Subunit Gamma-2, Recombinant, Human, aa417-588, His-GST-Tag, Myc-Tag

Artikelnummer: USB-585146
Artikelname: Laminin Subunit Gamma-2, Recombinant, Human, aa417-588, His-GST-Tag, Myc-Tag
Artikelnummer: USB-585146
Hersteller Artikelnummer: 585146
Alternativnummer: USB-585146-20,USB-585146-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ladsin exerts cell-scattering activity toward a wide variety of cells, including epithelial, endothelial, and fibroblastic cells. Source: Recombinant protein corresponding to aa417-588 from human Laminin subunit gamma-2, fused to 10X His-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~53.3kD Amino Acid Sequence: NCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 53.3
UniProt: Q13753
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.