Large-conductance Mechanosensitive Channel, Recombinant, E. coli O157:H7, aa1-136, His-B2M-Tag
Artikelnummer:
USB-585162
Hersteller Artikelnummer:
585162
Alternativnummer:
USB-585162-20,USB-585162-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell. Source: Recombinant protein corresponding to aa1-136 from Escherichia coli O157:H7 Large-conductance mechanosensitive channel, fused to 6X His-B2M-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~29.0kD Amino Acid Sequence: MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten