Latent Membrane Protein 2, Recombinant, Epstein-Barr virus, aa1-147, His-SUMO-Tag

Produktübersicht

• Artikelname: Latent Membrane Protein 2, Recombinant, Epstein-Barr virus, aa1-147, His-SUMO-Tag
• Artikelnummer: USB-585169
• Hersteller Artikelnummer: 585169
• Alternativnummer: USB-585169-20,USB-585169-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs., Isoform LMP2B may be a negative regulator of isoform LMP2A. Source: Recombinant protein corresponding to aa1-147 from Epstein-Barr virus Latent membrane protein 2, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.6kD Amino Acid Sequence: MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 31.6
• UniProt: P13285
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.