Limulus Clotting Factor C, Recombinant, Carcinoscorpius rotundicauda, aa691-1019, His-Tag

Artikelnummer: USB-585197
Artikelname: Limulus Clotting Factor C, Recombinant, Carcinoscorpius rotundicauda, aa691-1019, His-Tag
Artikelnummer: USB-585197
Hersteller Artikelnummer: 585197
Alternativnummer: USB-585197-20,USB-585197-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of factor B. Source: Recombinant protein corresponding to aa691-1019 from Carcinoscorpius rotundicauda Limulus clotting factor C,partial, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~39.2kD Amino Acid Sequence: SSQPSTVDLASKVKLPEGHYRVGSRAIYTCESRYYELLGSQGRRCDSNGNWSGRPASCIPVCGRSDSPRSPFIWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPNQFKMYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSETIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.2
UniProt: Q26422
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.