Lutropin-choriogonadotropic Hormone Receptor, Recombinant, Rat, aa27-362, Flag-Tag

Artikelnummer: USB-585225
Artikelname: Lutropin-choriogonadotropic Hormone Receptor, Recombinant, Rat, aa27-362, Flag-Tag
Artikelnummer: USB-585225
Hersteller Artikelnummer: 585225
Alternativnummer: USB-585225-20,USB-585225-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Source: Recombinant protein corresponding to aa27-362 from rat Lutropin-choriogonadotropic hormone receptor, fused to Flag-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~47.8kD Amino Acid Sequence: RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 47.8
UniProt: P16235
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol