Lymphocyte Antigen 6A-2/6E-1, Recombinant, Mouse, aa27-112, His-Tag, Myc-Tag

Artikelnummer: USB-585227
Artikelname: Lymphocyte Antigen 6A-2/6E-1, Recombinant, Mouse, aa27-112, His-Tag, Myc-Tag
Artikelnummer: USB-585227
Hersteller Artikelnummer: 585227
Alternativnummer: USB-585227-20,USB-585227-100
Hersteller: US Biological
Kategorie: Molekularbiologie
T-cell activation. Source: Recombinant protein corresponding to aa27-112 from mouse Lymphocyte antigen 6A-2/6E-1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~16.7kD Amino Acid Sequence: LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.7
UniProt: P05533
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.