Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida. May play a role in cell growth. Source: Recombinant protein corresponding to aa21-123 from mouse Lymphocyte antigen 6K, fused to 6X His-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~13.1kD Amino Acid Sequence: LTCHVCEAQNSYACSNPSQCPGEKKFCLLAVTRIFERFFYVSKQCTRRCPTPVVSPPSTNPPSEPKEFLIEKPMPFLFYKCCQWDSCNGEGPPTDQLLKEQPG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
