Lymphokine-activated Killer T-cell-originated Protein Kinase, Recombinant, Human, aa1-322, His-Tag

Produktübersicht

• Artikelname: Lymphokine-activated Killer T-cell-originated Protein Kinase, Recombinant, Human, aa1-322, His-Tag
• Artikelnummer: USB-585236
• Hersteller Artikelnummer: 585236
• Alternativnummer: USB-585236-20,USB-585236-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage. Source: Recombinant protein corresponding to aa1-322 from human Lymphokine-activated killer T-cell-originated protein kinase, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~42.1kD Amino Acid Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 42.1
• UniProt: Q96KB5
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.