Lysosome-associated Membrane Glycoprotein 5, Recombinant, Pongo abelii, aa30-234, His-Tag, Myc-Tag

Artikelnummer: USB-585250
Artikelname: Lysosome-associated Membrane Glycoprotein 5, Recombinant, Pongo abelii, aa30-234, His-Tag, Myc-Tag
Artikelnummer: USB-585250
Hersteller Artikelnummer: 585250
Alternativnummer: USB-585250-20,USB-585250-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain. Source: Recombinant protein corresponding to aa30-234 from Pongo abelii Lysosome-associated membrane glycoprotein 5, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~28kD Amino Acid Sequence: EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVGRCGHSESELQVFWVDRAYALKMLFVKESHNMSKGPEETWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCAVDEREQLEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28
UniProt: Q5R5V2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.