Macrophage Migration Inhibitory Factor, Recombinant, Mouse, aa2-115, His-Tag

Artikelnummer: USB-585277
Artikelname: Macrophage Migration Inhibitory Factor, Recombinant, Mouse, aa2-115, His-Tag
Artikelnummer: USB-585277
Hersteller Artikelnummer: 585277
Alternativnummer: USB-585277-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. Source: Recombinant protein corresponding to aa2-115 from human Macrophage migration inhibitory factor, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.9kD Amino Acid Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 13.9
UniProt: P34884
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol