Major Capsid Protein VP1, Recombinant, Rattus Norvegicus Polyomavirus 2, aa1-344, His-Tag

Produktübersicht

• Artikelname: Major Capsid Protein VP1, Recombinant, Rattus Norvegicus Polyomavirus 2, aa1-344, His-Tag
• Artikelnummer: USB-585289
• Hersteller Artikelnummer: 585289
• Alternativnummer: USB-585289-20,USB-585289-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-344 from Rattus norvegicus polyomavirus 2 Major capsid protein VP1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~44.4kD Amino Acid Sequence: MSRVTCQRKRLGPGRAPVQKLPRVIKKGGVEVLATVPPGPESEYKLEMFLKPCFGNDSGQAGPHYWNHSSPFTGEALTDGDYHVCYSMGQIQLPEISDQCSEEYMVVWECYRMETEVLYTPKITAAGLSGSNFLAVQGTQMYFWAVGGEPLDVMYMLPKEKMKPQGNLRAPSTTHSVYDPNIIREKLSSELYPVEYWTPDPSRNENTRYFGRIVGGAATPPVVTYSNSSTIPLLDENGVGVLCNQQRCYVTCADITGFLHNRIETAHGRFFRLHFRQRRVKNPYTMSLLYKQVLIQRPPQVAAQLGVTEVTIEEGQAPAPVMAQVGSCEPMITQQASSMLNVQG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 44.4
• UniProt: A0A2Z2DSF0
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.