Major Pollen Allergen Aln g 1, Recombinant, Alnus glutinosa, aa2-160, His-Tag

Artikelnummer: USB-585304
Artikelname: Major Pollen Allergen Aln g 1, Recombinant, Alnus glutinosa, aa2-160, His-Tag
Artikelnummer: USB-585304
Hersteller Artikelnummer: 585304
Alternativnummer: USB-585304-20,USB-585304-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa2-160 from Alnus glutinosa Major pollen allergen Aln g 1, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.2kD Amino Acid Sequence: GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.2
UniProt: P38948
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.