Major Pollen Allergen Car b 1 Isoform 2, Recombinant, Carpinus betulus, aa2-160, His-Tag

Produktübersicht

• Artikelname: Major Pollen Allergen Car b 1 Isoform 2, Recombinant, Carpinus betulus, aa2-160, His-Tag
• Artikelnummer: USB-585305
• Hersteller Artikelnummer: 585305
• Alternativnummer: USB-585305-20,USB-585305-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa2-160 from Carpinus betulus Major pollen allergen Car b 1 isoform 2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.4kD Amino Acid Sequence: GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 19.4
• UniProt: P38950
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.