Major Surface Antigen p30, Recombinant, Toxoplasma gondii, aa48-336, His-Tag, Myc-Tag

Artikelnummer: USB-585311
Artikelname: Major Surface Antigen p30, Recombinant, Toxoplasma gondii, aa48-336, His-Tag, Myc-Tag
Artikelnummer: USB-585311
Hersteller Artikelnummer: 585311
Alternativnummer: USB-585311-20,USB-585311-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Full length recombinant protein corresponding to aa48-336 from Toxoplasma gondii Major surface antigen p30, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Swiss/Uniprot: P13664 Molecular Weight: ~37.2kD Amino Acid Sequence: SDPPLVANQVVTCPDKKSTAAVILTPTENHFTLKCPKTALTEPPTLAYSPNRQICPAGTTSSCTSKAVTLSSLIPEAEDSWWTGDSASLDTAGIKLTVPIEKFPVTTQTFVVGCIKGDDAQSCMVTVTVQARASSVVNNVARCSYGADSTLGPVKLSAEGPTTMTLVCGKDGVKVPQDNNQYCSGTTLTGCNEKSFKDILPKLTENPWQGNASSDKGATLTIKKEAFPAESKSVIIGCTGGSPEKHHCTVKLEFAGAAGSAKSAAGTASHVSIFAMVIGLIGSIAACVA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 37.2
UniProt: P13664
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.