Matrix Protein, Recombinant, Rabies virus, aa1-202, His-B2M-Tag

Artikelnummer: USB-585347
Artikelname: Matrix Protein, Recombinant, Rabies virus, aa1-202, His-B2M-Tag
Artikelnummer: USB-585347
Hersteller Artikelnummer: 585347
Alternativnummer: USB-585347-20,USB-585347-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a major role in assembly, budding and uncoating of virion after membrane fusion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons. Source: Recombinant protein corresponding to aa1-202 from Rabies virus Matrix protein, fused to 6X His-B2M-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.2kD Amino Acid Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 37.2
UniProt: P15200
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.