Methyltransferase-like Protein 10, Recombinant, Mouse, aa1-244, His-Myc-Tag

Artikelnummer: USB-585393
Artikelname: Methyltransferase-like Protein 10, Recombinant, Mouse, aa1-244, His-Myc-Tag
Artikelnummer: USB-585393
Hersteller Artikelnummer: 585393
Alternativnummer: USB-585393-20,USB-585393-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at Lys-318. Source: Recombinant protein corresponding to aa1-244 from mouse Methyltransferase-like protein 10, fused to 6X His-Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~30.3kD Amino Acid Sequence: MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.3
UniProt: Q9D853
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.