Microcin J25-processing Protein mcjB, Recombinant, E. coli, aa1-208, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Microcin J25-processing Protein mcjB, Recombinant, E. coli, aa1-208, His-Tag, Myc-Tag
• Artikelnummer: USB-585398
• Hersteller Artikelnummer: 585398
• Alternativnummer: USB-585398-20,USB-585398-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Along with McjC, necessary and sufficient to process the inactive microcin J25 (McjA) precursor into the active peptide. Source: Recombinant protein corresponding to aa1-208 from Escherichia coli Microcin J25-processing protein mcjB, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~32.0kD Amino Acid Sequence: MIRYCLTSYREDLVILDIINDSFSIVPDAGSLLKERDKLLKEFPQLSYFFDSEYHIGSVSRNSDTSFLEERWFLPEPDKTLYKCSLFKRFILLLKVFYYSWNIEKKGMAWIFISNKKENRLYSLNEEHLIRKEISNLSIIFHLNIFKSDCLTYSYALKRILNSRNIDAHLVIGVRTQPFYSHSWVEVGGQVINDAPNMRDKLSVIAEI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 32
• UniProt: Q9X2V8
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.