MIG7, Recombinant, Human, aa1-207, His-SUMO-Tag

Artikelnummer: USB-585404
Artikelname: MIG7, Recombinant, Human, aa1-207, His-SUMO-Tag
Artikelnummer: USB-585404
Hersteller Artikelnummer: 585404
Alternativnummer: USB-585404-20, USB-585404-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-207 from human MIG7, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~35.3kD Amino Acid Sequence: MAASRCSGLSEMTLLGSQAVSGLSSPLKSPCQVWNSPSPVCVCVCVCVCVCTRVHMRACSAGSAYLKQMKFCRMAASLDKVKKTDRGERGSCVSTTKRQASLSQRDIPSNNMKLATFPSDVNVESVAASLFFTVMKLGATQLEWNTKTPLGNTSSGFESQLYHSPAIDSEQDLSEVISSQSVETRLTSKVLKVEPESMNAKVFTFKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.3
UniProt: Q1AHR6
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.