Mitochondrial Protein Import Protein mas5, Recombinant, Schizosaccharomyces pombe, aa1-404, His-Tag

Produktübersicht

• Artikelname: Mitochondrial Protein Import Protein mas5, Recombinant, Schizosaccharomyces pombe, aa1-404, His-Tag
• Artikelnummer: USB-585415
• Hersteller Artikelnummer: 585415
• Alternativnummer: USB-585415-20, USB-585415-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Probably involved in mitochondrial protein import. Plays a role in microtubule cytoskeleton organization. Source: Recombinant protein corresponding to aa1-404 from Schizosaccharomyces pombe Mitochondrial protein import protein mas5, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~51.5kD Amino Acid Sequence: MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRWLTIPIIPGECIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPNFATPEQLALLEKALPPRKIESAPKNAHTEECVLATVDPTEKVRIDNNVDPTTATSMDEDEDEEGGHPGVQC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 51.5
• UniProt: O74752
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.