Modification Methylase EcoRV, Recombinant, E. coli, aa1-298, His-SUMO-Tag

Artikelnummer: USB-585421
Artikelname: Modification Methylase EcoRV, Recombinant, E. coli, aa1-298, His-SUMO-Tag
Artikelnummer: USB-585421
Hersteller Artikelnummer: 585421
Alternativnummer: USB-585421-20, USB-585421-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This methylase recognizes the double-stranded sequence GATATC, causes specific methylation on A-2 on both strands, and protects the DNA from cleavage by the EcoRV endonuclease. Source: Recombinant protein corresponding to aa1-298 from Escherichia coli Modification methylase EcoRV, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~50.6kD Amino Acid Sequence: MKDKVFVPPIKSQGIKTKLVPCIKRIVPKNFNGVWVEPFMGTGVVAFNVAPKDALLCDTNPHLISFYNALKNKDITGDLVKDFLYREGEKLLLSNGEYYYEVRERFNNYKEPLDFLFLNRSCFNGMIRFNSKGGFNVPFCKKPNRFAQAYITKISNQVDRISEIISKGNYTFLCQSFEKTIGMVNRDDVVYCDPPYIGRHVDYFNSWGERDERLLFETLSSLNATFITSTWHHNDYRENKYVRDLWSSFRILTKEHFYHVGASEKNRSPMVEALITNIAKDIIDHIEKSSGDILVIEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 50.6
UniProt: P04393
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.