Monoglyceride Lipase, Recombinant, Mouse, aa1-303, His-SUMO-Tag

Artikelnummer: USB-585425
Artikelname: Monoglyceride Lipase, Recombinant, Mouse, aa1-303, His-SUMO-Tag
Artikelnummer: USB-585425
Hersteller Artikelnummer: 585425
Alternativnummer: USB-585425-20,USB-585425-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Source: Recombinant protein corresponding to aa1-303 from mouse Monoglyceride lipase, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~49.4kD Amino Acid Sequence: MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 49.4
UniProt: O35678
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.