mRNA Interferase MazF, Recombinant, Staphylococcus aureus, aa1-120, His-Tag

Artikelnummer: USB-585431
Artikelname: mRNA Interferase MazF, Recombinant, Staphylococcus aureus, aa1-120, His-Tag
Artikelnummer: USB-585431
Hersteller Artikelnummer: 585431
Alternativnummer: USB-585431-20, USB-585431-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5-UACAU-3 in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE. Source: Recombinant protein corresponding to aa1-120 from Staphylococcus aureus mRNA interferase MazF, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.4kD Amino Acid Sequence: MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.4
UniProt: Q7A0D7
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.