Mucin-2, Recombinant, Human, aa36-240, His-Tag

Artikelnummer: USB-585436
Artikelname: Mucin-2, Recombinant, Human, aa36-240, His-Tag
Artikelnummer: USB-585436
Hersteller Artikelnummer: 585436
Alternativnummer: USB-585436-20,USB-585436-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer. Source: Recombinant protein corresponding to aa36-240 from human Mucin-2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.8kD Amino Acid Sequence: VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.8
UniProt: Q02817
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.