Mucin-5B, Recombinant, Human, aa4186-4295, His-Tag, Myc-Tag

Artikelnummer: USB-585438
Artikelname: Mucin-5B, Recombinant, Human, aa4186-4295, His-Tag, Myc-Tag
Artikelnummer: USB-585438
Hersteller Artikelnummer: 585438
Alternativnummer: USB-585438-20, USB-585438-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Gel-forming mucin that is thought to contribute to the lubricating and viscoelastic properties of whole saliva and cervical mucus. Source: Recombinant protein corresponding to aa4186-4295 from human Mucin-5B, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~18.9kD Amino Acid Sequence: ELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.9
UniProt: Q9HC84
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.