Mucosal Addressin Cell Adhesion Molecule 1, Recombinant, Rat, aa20-353, His-SUMO-Tag

Produktübersicht

• Artikelname: Mucosal Addressin Cell Adhesion Molecule 1, Recombinant, Rat, aa20-353, His-SUMO-Tag
• Artikelnummer: USB-585442
• Hersteller Artikelnummer: 585442
• Alternativnummer: USB-585442-20, USB-585442-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes (By similarity). Source: Recombinant protein corresponding to aa20-353 from rat Mucosal addressin cell adhesion molecule 1, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~52.0kD Amino Acid Sequence: QSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARVHWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVCVGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGRDQVVSCTAHNIWPAGPDSLSFALLRGEQSLEGAQALETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALPALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPSTTSAKPYILTSSHTTKAVSTGLSSVALPSTPLSSEGPCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPGDLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDPGGQVTSLYVTGQVIPNPSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 52
• UniProt: O70540
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.