Myelin Protein P0, Recombinant, Human, aa30-156, His-Tag
Artikelnummer:
USB-585447
Hersteller Artikelnummer:
585447
Alternativnummer:
USB-585447-20, USB-585447-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction. Source: Recombinant protein corresponding to aa30-156 from human Myelin protein P0, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~18.5kD Amino Acid Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten