Myelin-oligodendrocyte Glycoprotein, Recombinant, Human, aa30-154, His-Tag

Artikelnummer: USB-585448
Artikelname: Myelin-oligodendrocyte Glycoprotein, Recombinant, Human, aa30-154, His-Tag
Artikelnummer: USB-585448
Hersteller Artikelnummer: 585448
Alternativnummer: USB-585448-20, USB-585448-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication., (Microbial infection) Acts as a receptor for rubella virus. Source: Recombinant protein corresponding to aa30-154 from human Myelin-oligodendrocyte glycoprotein, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.9kD Amino Acid Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.9
UniProt: Q16653
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.