N-acyl Homoserine Lactonase AiiA, Recombinant, Bacillus Thuringiensis Subsp. Kurstaki, aa1-250, His-Tag, Myc-Tag

Artikelnummer: USB-585462
Artikelname: N-acyl Homoserine Lactonase AiiA, Recombinant, Bacillus Thuringiensis Subsp. Kurstaki, aa1-250, His-Tag, Myc-Tag
Artikelnummer: USB-585462
Hersteller Artikelnummer: 585462
Alternativnummer: USB-585462-20, USB-585462-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Catalyzes hydrolysis of N-hexanoyl-(S)-homoserine lactone, but not the R-enantiomer. Hydrolyzes short- and long-chain N-acyl homoserine lactones with or without 3-oxo substitution at C3, has maximum activity on C10-AHL. Source: Recombinant protein corresponding to aa1-250 from Bacillus thuringiensis subsp. kurstaki N-acyl homoserine lactonase AiiA, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~35.7kD Amino Acid Sequence: MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.7
UniProt: P0CJ63
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.