Nephrin, Recombinant, Human, aa23-257, His-Tag

Artikelnummer: USB-585488
Artikelname: Nephrin, Recombinant, Human, aa23-257, His-Tag
Artikelnummer: USB-585488
Hersteller Artikelnummer: 585488
Alternativnummer: USB-585488-20,USB-585488-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion. Recombinant protein corresponding to aa23-257 from human Nephrin, fused to 10X His-Tag at N-terminal, expressed in Mammalian cell. Uniprot/Accession: O60500. Molecular Weight: ~27.5kD Amino Acid Sequence: QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.5
UniProt: O60500
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris-HCL, pH 8.0, 1mM EDTA, 50% glycerol.