Neuronal Acetylcholine Receptor Subunit Beta-2, Recombinant, Human, aa26-233, His-V5-Tag

Artikelnummer: USB-585507
Artikelname: Neuronal Acetylcholine Receptor Subunit Beta-2, Recombinant, Human, aa26-233, His-V5-Tag
Artikelnummer: USB-585507
Hersteller Artikelnummer: 585507
Alternativnummer: USB-585507-20,USB-585507-100
Hersteller: US Biological
Kategorie: Molekularbiologie
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions. Source: Recombinant protein corresponding to aa26-233 from human Neuronal acetylcholine receptor subunit beta-2, fused to 10X His-V5-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.9kD Amino Acid Sequence: TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.9
UniProt: P17787
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.