Neurotrophin-4, Recombinant, Human, aa82-210, His-Tag

Artikelnummer: USB-585516
Artikelname: Neurotrophin-4, Recombinant, Human, aa82-210, His-Tag
Artikelnummer: USB-585516
Hersteller Artikelnummer: 585516
Alternativnummer: USB-585516-20, USB-585516-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Target-derived survival factor for peripheral sensory sympathetic neurons. Recombinant protein corresponding to aa82-210 from human Neurotrophin-4, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.9kD Amino Acid Sequence: VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.9
UniProt: P34130
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.