Neutrophil Defensin 3, Recombinant, Human, aa39-94, His-SUMO-Tag

Artikelnummer: USB-585518
Artikelname: Neutrophil Defensin 3, Recombinant, Human, aa39-94, His-SUMO-Tag
Artikelnummer: USB-585518
Hersteller Artikelnummer: 585518
Alternativnummer: USB-585518-20, USB-585518-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. Source: Recombinant protein corresponding to aa39-94 from human Neutrophil defensin 3, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~22.4kD Amino Acid Sequence: DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 22.4
UniProt: P59666
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.