Nitrogenase iron Protein 1, Recombinant, Methanobacterium ivanovii, aa1-275, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Nitrogenase iron Protein 1, Recombinant, Methanobacterium ivanovii, aa1-275, His-Tag, Myc-Tag
• Artikelnummer: USB-585527
• Hersteller Artikelnummer: 585527
• Alternativnummer: USB-585527-20, USB-585527-200
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein. Source: Recombinant protein corresponding to aa1-275 from Methanobacterium ivanovii Nitrogenase iron protein 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~37.4kD Amino Acid Sequence: MVRKIAIYGKGGIGKSTTTQNTASAMAHFHNQRVMIHGCDPKADSTRMILGGKMQTTMMDTLREEGEEACMDLDNVMSTGFKDIKCVESGGPEPGVGCAGRGVITAITIMEHMKVYDDNDFVFFDVLGDVVCGGFAMPIRDGKAEEIYIVASGEMMALYAANNLCKGMVKYAEQSGVRLGGIICNSRNVDGEKELLEEFCKRIGTQMIHFVPRDNIVQKAEFNKRTVVDFDAECSQAHEYSELARKIIENDNFVIPDPMTMDELEEMVVSYGLMD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 37.4
• UniProt: P51602
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.